PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 445aa    MW: 50362.3 Da    PI: 9.6437
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523905.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.82.4e-08132174346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eE ++l d+++++  + +  Ia ++++ Rt +++k+r+++
   XP_010523905.1 132 VWTKEETDQLFDLCERFDLR-FIVIADRFPLSRTVEELKDRYYS 174
                      6*******************.*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162827.1E-31105179IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007171.3E-7129178IPR001005SANT/Myb domain
SuperFamilySSF466891.88E-6130179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-6132177IPR009057Homeodomain-like
CDDcd116583.94E-19133175No hitNo description
PfamPF054991.5E-7322386IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MGGTDAKDIL GLPKTPLSIT QEKKPRPQKE SHRKPDGISR EVYALTGGIP PLMPSIDVSQ  60
LKRRPPADEK VVWRWLPFTN SARKDNLQLY HWVRVVNDVP PTGDYSFAKY NKSVDIMKYT  120
DEEYEKYLTD PVWTKEETDQ LFDLCERFDL RFIVIADRFP LSRTVEELKD RYYSVTRALL  180
RVRAQSPADV ANHPLIKEQY DITRDRDRKR ALSVVLSQTR QQEKKDTEIL AEAKRITEAR  240
LAAWSTEEPD VPVNATAGPE KADGVVVPGD SVSPSANVPP PTSGAAPSTL VMPDNASTIA  300
SLRMLRVYLR TYALEQMVQA ASSSVGLRTI KRVEQTLQDL GVNLKPKVPT KTVCDEHLEL  360
RKEILTLLNL QKQLQYKEAE GSSYREGSYA EMPEPPQDRV FAQEPFSFGA ERPTKKDQKR  420
KGPGRQANTP SPAHKRPRKM KASDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A2e-22104184488DNA methyltransferase 1-associated protein 1
4iej_A2e-22104184488DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523905.10.0PREDICTED: DNA methyltransferase 1-associated protein 1 isoform X2
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLD7LG020.0D7LG02_ARALL; Myb family transcription factor
STRINGscaffold_403698.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein